Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stromal cell-derived factor 2 (SDF2)

Product Specifications

Product Name Alternative

SDF2Stromal cell-derived factor 2; SDF-2

Abbreviation

Recombinant Human SDF2 protein

Gene Name

SDF2

UniProt

Q99470

Expression Region

19-211aa

Organism

Homo sapiens (Human)

Target Sequence

SSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.3 kDa

References & Citations

Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST3GAL4 Adenovirus (Rat)
45632056 1.0 mL

ST3GAL4 Adenovirus (Rat)

Sign In for Pricing
View Details
Sheep Phenylalanine Hydroxylase ELISA Kit
MBS057458-01 48 Well

Sheep Phenylalanine Hydroxylase ELISA Kit

Sign In for Pricing
View Details
Sheep Phenylalanine Hydroxylase ELISA Kit
MBS057458-02 96 Well

Sheep Phenylalanine Hydroxylase ELISA Kit

Sign In for Pricing
View Details
Sheep Phenylalanine Hydroxylase ELISA Kit
MBS057458-03 5x 96 Well

Sheep Phenylalanine Hydroxylase ELISA Kit

Sign In for Pricing
View Details
Sheep Phenylalanine Hydroxylase ELISA Kit
MBS057458-04 10x 96 Well

Sheep Phenylalanine Hydroxylase ELISA Kit

Sign In for Pricing
View Details
ELISA Kit For Prolyl 4-hydroxylase subunit alpha-2
E10872c 96 Tests

ELISA Kit For Prolyl 4-hydroxylase subunit alpha-2

Sign In for Pricing
View Details