Recombinant Human Protein SCO2 homolog, mitochondrial (SCO2)
Product Specifications
Product Name Alternative
Cytochrome oxidase deficient homolog 2; MGC125823; MGC125825; OTTHUMP00000196774; OTTHUMP00000196775; Protein SCO2 homolog; mitochondrial; SCO (cytochrome oxidase deficient; yeast) homolog 2; SCO 1L; SCO 2; SCO cytochrome oxidase deficient homolog 2 (yeast) ; SCO cytochrome oxidase deficient homolog 2; SCO1L; SCO2; SCO2_HUMAN; Synthesis of cytochrome c oxidase 2
Abbreviation
Recombinant Human SCO2 protein
Gene Name
SCO2
UniProt
O43819
Expression Region
43-266aa
Organism
Homo sapiens (Human)
Target Sequence
PAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
Tag
N-terminal 6xHis-SUMO-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Metabolism
Relevance
Acts as a copper chaperone, transporting copper to the Cu (A) site on the cytochrome c oxidase subunit II (COX2) .
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Acts as a copper chaperone, transporting copper to the Cu (A) site on the cytochrome c oxidase subunit II (COX2) .
Molecular Weight
41.1 kDa
References & Citations
Mutations in SCO2 are associated with autosomal-dominant high-grade myopia.Tran-Viet K.N., Powell C., Barathi V.A., Klemm T., Maurer-Stroh S., Limviphuvadh V., Soler V., Ho C., Yanovitch T., Schneider G., Li Y.J., Nading E., Metlapally R., Saw S.M., Goh L., Rozen S., Young T.L.Am. J. Hum. Genet. 92:820-826 (2013)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400012-500 1x 500 µL
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880994-100 1x 100 µL
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details