Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A4 (S100A4)

Product Specifications

Product Name Alternative

Calvasculin; Metastasin; Placental calcium-binding protein; Protein Mts1S100 calcium-binding protein A4

Abbreviation

Recombinant Human S100A4 protein

Gene Name

S100A4

UniProt

P26447

Expression Region

2-101aa

Organism

Homo sapiens (Human)

Target Sequence

ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.6 kDa

References & Citations

Transcriptional analysis of the mts1 gene with specific reference to 5' flanking sequences.Tulchinsky E.M., Ford H.L., Kramerov D., Reshetnyak E., Grigorian M., Zain S., Lukanidin E.Proc. Natl. Acad. Sci. U.S.A. 89:9146-9150 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdh26 Mouse Gene Knockout Kit (CRISPR)
KN503012 1 Kit

Cdh26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL12A Mouse Monoclonal Antibody [Clone ID: OTI1G5]
CF808129 100 µg

IL12A Mouse Monoclonal Antibody [Clone ID: OTI1G5]

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker), CF405S conjugate, 0.1mg/mL
BNC041662-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Apolipoprotein L 5 (APOL5) activation kit by CRISPRa
GA112995 1 Kit

Human Apolipoprotein L 5 (APOL5) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Gastroesophageal junction
CS628134 5x 5 µm

Frozen Tissue Sections, Gastroesophageal junction

Sign In for Pricing
View Details
Rpp25l Mouse Gene Knockout Kit (CRISPR)
KN515068 1 Kit

Rpp25l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details