Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A1 (S100A1)

Product Specifications

Product Name Alternative

S-100 protein alpha chain; S-100 protein subunit alpha; S100 calcium-binding protein A1

Abbreviation

Recombinant Human S100A1 protein

Gene Name

S100A1

UniProt

P23297

Expression Region

2-94aa

Organism

Homo sapiens (Human)

Target Sequence

GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probably acts as a Ca (2+) signal transducer

Molecular Weight

26.4 kDa

References & Citations

S100 alpha, CAPL, and CACY molecular cloning and expression analysis of three calcium-binding proteins from human heart.Engelkamp D., Schaefer B.W., Erne P., Heizmann C.W.Biochemistry 31:10258-10264 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: left
CS637443 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Drop-n-Stain EverBriteTM Mounting Medium with DAPI
#23009 1x 10 mL

Drop-n-Stain EverBriteTM Mounting Medium with DAPI

Sign In for Pricing
View Details
Gastrin (GAST/2635), CF640R conjugate, 0.1mg/mL
BNC402635-500 1x 500 µL

Gastrin (GAST/2635), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UPP2 Mouse Monoclonal Antibody [Clone ID: OTI10A3]
CF812317 100 µg

UPP2 Mouse Monoclonal Antibody [Clone ID: OTI10A3]

Sign In for Pricing
View Details
(S,S)-(-)-Hydrobenzoin
TRC-H714520-5G 5 g

(S,S)-(-)-Hydrobenzoin

Sign In for Pricing
View Details
C-Myc (9E10.3), CF568 conjugate, 0.1mg/mL
BNC680596-500 1x 500 µL

C-Myc (9E10.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details