Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A1 (S100A1)

Product Specifications

Product Name Alternative

S-100 protein alpha chain; S-100 protein subunit alpha; S100 calcium-binding protein A1

Abbreviation

Recombinant Human S100A1 protein

Gene Name

S100A1

UniProt

P23297

Expression Region

2-94aa

Organism

Homo sapiens (Human)

Target Sequence

GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probably acts as a Ca (2+) signal transducer

Molecular Weight

26.4 kDa

References & Citations

S100 alpha, CAPL, and CACY molecular cloning and expression analysis of three calcium-binding proteins from human heart.Engelkamp D., Schaefer B.W., Erne P., Heizmann C.W.Biochemistry 31:10258-10264 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARPP21 Rabbit Polyclonal Antibody
TA362309 100 µL

ARPP21 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CACNA1C (NM_000719) Human Over-expression Lysate
LY424548 100 µg

CACNA1C (NM_000719) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome P450 3A5 (CYP3A5) (NM_000777) Human Recombinant Protein
TP307432 20 µg

Cytochrome P450 3A5 (CYP3A5) (NM_000777) Human Recombinant Protein

Sign In for Pricing
View Details
Pea3 (ETV4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A10]
TA811405AM 100 µL

Pea3 (ETV4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A10]

Sign In for Pricing
View Details
Frozen Tissue Sections, Brain
CS639473 5x 5 µm

Frozen Tissue Sections, Brain

Sign In for Pricing
View Details
UBQLNL Rabbit Polyclonal Antibody
TA383050 100 µL

UBQLNL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details