Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Resistin (Retn)

Product Specifications

Product Name Alternative

Adipose tissue-specific secretory factor ; ADSFAdipose-specific cysteine-rich secreted protein A12-alpha; Cysteine-rich secreted protein FIZZ3

Abbreviation

Recombinant Mouse Retn protein

Gene Name

Retn

UniProt

Q99P87

Expression Region

21-114aa

Organism

Mus musculus (Mouse)

Target Sequence

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Hormone that ses to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.

Molecular Weight

14.2 kDa

References & Citations

Disulfide-dependent multimeric assembly of resistin family hormones.Patel S.D., Rajala M.W., Rossetti L., Scherer P.E., Shapiro L.Science 304:1154-1158 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSG7 siRNA (Human)
MBS8226866-01 15 nmol

PSG7 siRNA (Human)

Sign In for Pricing
View Details
PSG7 siRNA (Human)
MBS8226866-02 30 nmol

PSG7 siRNA (Human)

Sign In for Pricing
View Details
PSG7 siRNA (Human)
MBS8226866-03 5x 30 nmol

PSG7 siRNA (Human)

Sign In for Pricing
View Details
USP38 Antibody
CSB-PA004396-01 50 µg

USP38 Antibody

Sign In for Pricing
View Details
USP38 Antibody
CSB-PA004396-02 100 µg

USP38 Antibody

Sign In for Pricing
View Details
FOXO6 (Forkhead box Protein O6, FOXO6) (Biotin)
MBS6456186-01 0.2 mL

FOXO6 (Forkhead box Protein O6, FOXO6) (Biotin)

Sign In for Pricing
View Details