Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Regenerating islet-derived protein 3-alpha (REG3A)

Product Specifications

Product Name Alternative

Hepatointestinal pancreatic protein ; HIP/PAPHuman proislet peptidePancreatitis-associated protein 1Regenerating islet-derived protein III-alpha ; Reg III-alpha

Abbreviation

Recombinant Human REG3A protein

Gene Name

REG3A

UniProt

Q06141

Expression Region

27-175aa

Organism

Homo sapiens (Human)

Target Sequence

EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.

Molecular Weight

43.6 kDa

References & Citations

Molecular basis for peptidoglycan recognition by a bactericidal lectin.Lehotzky R.E., Partch C.L., Mukherjee S., Cash H.L., Goldman W.E., Gardner K.H., Hooper L.V.Proc. Natl. Acad. Sci. U.S.A. 107:7722-7727 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab 30 Lentiviral Activation Particles (h2)
sc-411991-LAC-2 200 µL

Rab 30 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Lithium 2- (6- (1H-Imidazol-1-Yl) Pyridazine-3-Carboxamido) -4,5-Difluorobenzoate
PC108442-01 100 mg

Lithium 2- (6- (1H-Imidazol-1-Yl) Pyridazine-3-Carboxamido) -4,5-Difluorobenzoate

Sign In for Pricing
View Details
Lithium 2- (6- (1H-Imidazol-1-Yl) Pyridazine-3-Carboxamido) -4,5-Difluorobenzoate
PC108442-02 250 mg

Lithium 2- (6- (1H-Imidazol-1-Yl) Pyridazine-3-Carboxamido) -4,5-Difluorobenzoate

Sign In for Pricing
View Details
Lithium 2- (6- (1H-Imidazol-1-Yl) Pyridazine-3-Carboxamido) -4,5-Difluorobenzoate
PC108442-03 1 g

Lithium 2- (6- (1H-Imidazol-1-Yl) Pyridazine-3-Carboxamido) -4,5-Difluorobenzoate

Sign In for Pricing
View Details
DYDC1 Antibody
OAEB00988-100UG 100 µg

DYDC1 Antibody

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)
MBS2059920-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)

Sign In for Pricing
View Details