Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Recoverin (RCVRN)

Product Specifications

Product Name Alternative

Cancer-associated retinopathy protein ; Protein CAR

Abbreviation

Recombinant Human RCVRN protein

Gene Name

RCVRN

UniProt

P35243

Expression Region

2-200aa

Organism

Homo sapiens (Human)

Target Sequence

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Ses to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.

Molecular Weight

27 kDa

References & Citations

Expression of a photoreceptor protein, recoverin, as a cancer-associated retinopathy autoantigen in human lung cancer cell lines.Matsubara S., Yamaji Y., Sato M., Fujita J., Takahara J.Br. J. Cancer 74:1419-1422 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP14 Human Gene Knockout Kit (CRISPR)
KN208917RB 1 Kit

MMP14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pararosaniline Base
TRC-P193288-5G 5 g

Pararosaniline Base

Sign In for Pricing
View Details
Ethyl 4-hydroxybutanoate
TRC-E945743-10MG 10 mg

Ethyl 4-hydroxybutanoate

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS707213 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Kv2.1 (KCNB1) (NM_004975) Human Over-expression Lysate
LC401551 20 µg

Kv2.1 (KCNB1) (NM_004975) Human Over-expression Lysate

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1799R), Biotin conjugate, 0.1mg/mL
BNCB1799-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1799R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details