Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parathyroid hormone 2 receptor (PTH2R), partial

Product Specifications

Product Name Alternative

Parathyroid hormone 2 receptor; Parathyroid hormone receptor precursor ; PTH 2 receptor ; PTH2 receptor; Pth2r; PTH2R_HUMAN; Pthr 2; Pthr2

Abbreviation

Recombinant Human PTH2R protein, partial

Gene Name

PTH2R

UniProt

P49190

Expression Region

27-145aa

Organism

Homo sapiens (Human)

Target Sequence

DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systs. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor (By similarity) .

Molecular Weight

29.6 kDa

References & Citations

Identification and characterization of the murine and human gene encoding the tuberoinfundibular peptide of 39 residues.John M.R., Arai M., Rubin D.A., Jonsson K.B., Jueppner H.Endocrinology 143:1047-1057 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR561820 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
PADI4 Antibody (Biotin)
KB-12116-01 50 μL

PADI4 Antibody (Biotin)

Sign In for Pricing
View Details
PADI4 Antibody (Biotin)
KB-12116-02 100 µL

PADI4 Antibody (Biotin)

Sign In for Pricing
View Details
PADI4 Antibody (Biotin)
KB-12116-03 1 mL

PADI4 Antibody (Biotin)

Sign In for Pricing
View Details
4,4'-Oxydibenzenesulfonyl Hydrazide
TRC-O870638-5G 5 g

4,4'-Oxydibenzenesulfonyl Hydrazide

Sign In for Pricing
View Details
Recombinant PCNA Monoclonal Antibody
AN300996L-01 50 µL

Recombinant PCNA Monoclonal Antibody

Sign In for Pricing
View Details