Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parathyroid hormone 2 receptor (PTH2R), partial

Product Specifications

Product Name Alternative

Parathyroid hormone 2 receptor; Parathyroid hormone receptor precursor ; PTH 2 receptor ; PTH2 receptor; Pth2r; PTH2R_HUMAN; Pthr 2; Pthr2

Abbreviation

Recombinant Human PTH2R protein, partial

Gene Name

PTH2R

UniProt

P49190

Expression Region

27-145aa

Organism

Homo sapiens (Human)

Target Sequence

DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systs. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor (By similarity) .

Molecular Weight

29.6 kDa

References & Citations

Identification and characterization of the murine and human gene encoding the tuberoinfundibular peptide of 39 residues.John M.R., Arai M., Rubin D.A., Jonsson K.B., Jueppner H.Endocrinology 143:1047-1057 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10X Brilliant Thallium Assay Buffer
7010T 10 mL

10X Brilliant Thallium Assay Buffer

Sign In for Pricing
View Details
Human CILP2 activation kit by CRISPRa
GA115653 1 Kit

Human CILP2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF640R conjugate, 0.1mg/mL
BNC400634-100 1x 100 µL

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS713297 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Aldolase A/B/C Recombinant Chimeric Antibody Antibody
HA610341 100 µL

Aldolase A/B/C Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
TAS2R38 (NM_176817) Human Over-expression Lysate
LC403589 20 µg

TAS2R38 (NM_176817) Human Over-expression Lysate

Sign In for Pricing
View Details