Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteasome subunit alpha type-1 (PSMA1), partial

Product Specifications

Product Name Alternative

30KDA prosomal protein ; PROS-30Macropain subunit C2Multicatalytic endopeptidase complex subunit C2; Proteasome component C2; Proteasome nu chain

Abbreviation

Recombinant Human PSMA1 protein, partial

Gene Name

PSMA1

UniProt

P25786

Expression Region

1-251aa

Organism

Homo sapiens (Human)

Target Sequence

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPAD

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal transduction in the macrophage proteasome . Might be involved in the anti-inflammatory response of macrophages during the interaction with C.albicans heat-inactivated cells .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex) .

Molecular Weight

32.2 kDa

References & Citations

"N-terminome analysis of the human mitochondrial proteome."Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M., Ayoub D., Lane L., Bairoch A., Van Dorsselaer A., Carapito C.Proteomics 15:2519-2524 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bentamapimod
GW3290-1mg 1 mg

Bentamapimod

Ask
View Details
Human monoamine oxidase A, MAOA ELISA Kit
MBS163892-01 48 Well

Human monoamine oxidase A, MAOA ELISA Kit

Ask
View Details
Human monoamine oxidase A, MAOA ELISA Kit
MBS163892-02 96 Well

Human monoamine oxidase A, MAOA ELISA Kit

Ask
View Details
Human monoamine oxidase A, MAOA ELISA Kit
MBS163892-03 5x 96 Well

Human monoamine oxidase A, MAOA ELISA Kit

Ask
View Details
Human monoamine oxidase A, MAOA ELISA Kit
MBS163892-04 10x 96 Well

Human monoamine oxidase A, MAOA ELISA Kit

Ask
View Details
ZPLD1 (Zona Pellucida-like Domain-containing Protein 1, ZP Domain-containing Protein 1) (MaxLight 490)
MBS6204248-01 0.1 mL

ZPLD1 (Zona Pellucida-like Domain-containing Protein 1, ZP Domain-containing Protein 1) (MaxLight 490)

Ask
View Details