Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostate stem cell antigen (PSCA)

Product Specifications

Product Name Alternative

PSCA; UNQ206/PRO232; Prostate stem cell antigen

Abbreviation

Recombinant Human PSCA protein

Gene Name

PSCA

UniProt

O43653

Expression Region

12-86aa

Organism

Homo sapiens (Human)

Target Sequence

LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.

Molecular Weight

35.7 kDa

References & Citations

Genetic variation in PSCA is associated with susceptibility to diffuse-type gastric cancer.The study group of millennium genome project for cancerSakamoto H., Yoshimura K., Saeki N., Katai H., Shimoda T., Matsuno Y., Saito D., Sugimura H., Tanioka F., Kato S., Matsukura N., Matsuda N., Nakamura T., Hyodo I., Nishina T., Yasui W., Hirose H., Hayashi M. , Toshiro E., Ohnami S., Sekine A., Sato Y., Totsuka H., Ando M., Takemura R., Takahashi Y., Ohdaira M., Aoki K., Honmyo I., Chiku S., Aoyagi K., Sasaki H., Ohnami S., Yanagihara K., Yoon K.-A., Kook M.-C., Lee Y.-S., Park S.R., Kim C.G., Choi I.J., Yoshida T., Nakamura Y., Hirohashi S.Nat. Genet. 40:730-740 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Hydroxyanthranilic acid
MBS3609614-01 100 mg

3-Hydroxyanthranilic acid

Sign In for Pricing
View Details
3-Hydroxyanthranilic acid
MBS3609614-02 5x 100 mg

3-Hydroxyanthranilic acid

Sign In for Pricing
View Details
ZAR1L Double Nickase Plasmid (m2)
sc-436819-NIC-2 20 µg

ZAR1L Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
BCL9L Blocking Peptide
MBS9615332-01 1 mg

BCL9L Blocking Peptide

Sign In for Pricing
View Details
BCL9L Blocking Peptide
MBS9615332-02 5x 1 mg

BCL9L Blocking Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal SCAMP2 Antibody [DyLight 594]
NB120-3431DL594 0.1 mL

Rabbit Polyclonal SCAMP2 Antibody [DyLight 594]

Sign In for Pricing
View Details