Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Prolactin (PRL)

Product Specifications

Product Name Alternative

PRL; Prolactin; PRL

Abbreviation

Recombinant Pig PRL protein

Gene Name

PRL

UniProt

P01238

Expression Region

31-229aa

Organism

Sus scrofa (Pig)

Target Sequence

LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Prolactin acts primarily on the mammary gland by promoting lactation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Prolactin acts primarily on the mammary gland by promoting lactation.

Molecular Weight

39 kDa

References & Citations

Nucleotide sequence of porcine preprolactin cDNA.Schulz Aellen M.F., Schmid E., Movva R.N.Nucleic Acids Res. 17:3295-3295 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Solo (SESTD1) Mouse Monoclonal Antibody [Clone ID: LBI2E7]
AMM13562VCF 100 µg

Solo (SESTD1) Mouse Monoclonal Antibody [Clone ID: LBI2E7]

Sign In for Pricing
View Details
Camel Aldosterone Synthase ELISA Kit
MBS084552-01 48 Well

Camel Aldosterone Synthase ELISA Kit

Sign In for Pricing
View Details
Camel Aldosterone Synthase ELISA Kit
MBS084552-02 96 Well

Camel Aldosterone Synthase ELISA Kit

Sign In for Pricing
View Details
Camel Aldosterone Synthase ELISA Kit
MBS084552-03 5x 96 Well

Camel Aldosterone Synthase ELISA Kit

Sign In for Pricing
View Details
Camel Aldosterone Synthase ELISA Kit
MBS084552-04 10x 96 Well

Camel Aldosterone Synthase ELISA Kit

Sign In for Pricing
View Details
Recombinant Ochrobactrum anthropi Undecaprenyl-diphosphatase (uppP), partial
MBS1178450-01 1 mg (E-Coli)

Recombinant Ochrobactrum anthropi Undecaprenyl-diphosphatase (uppP), partial

Sign In for Pricing
View Details