Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)

Product Specifications

Product Name Alternative

66.3KDA protein76KDA protein ; p76LAMA-like protein 2Lamina ancestor homolog 2; Phospholipase B domain-containing protein 2

Abbreviation

Recombinant Mouse Plbd2 protein

Gene Name

Plbd2

UniProt

Q3TCN2

Expression Region

47-594aa

Organism

Mus musculus (Mouse)

Target Sequence

LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Putative phospholipase.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Putative phospholipase.

Molecular Weight

65.9 kDa

References & Citations

De novo sulfur SAD phasing of the lysosomal 66.3KDA protein from mouse.Lakomek K., Dickmanns A., Mueller U., Kollmann K., Deuschl F., Berndt A., Lubke T., Ficner R.Acta Crystallogr. D 65:220-228 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGRPL (PGLYRP2) (NM_052890) Human Tagged Lenti ORF Clone
RC215773L1 10 µg

PGRPL (PGLYRP2) (NM_052890) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
bcl 6 (BCL6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C3]
TA804186BM 100 µL

bcl 6 (BCL6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C3]

Sign In for Pricing
View Details
Olr712 Protein Vector (Rat) (pPM-C-HA)
PV290900 500 ng

Olr712 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PDIK1L Rabbit Polyclonal Antibody
APRab15913-01 20 µL

PDIK1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDIK1L Rabbit Polyclonal Antibody
APRab15913-02 50 µL

PDIK1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDIK1L Rabbit Polyclonal Antibody
APRab15913-03 100 µL

PDIK1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details