Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Elafin (PI3)

Product Specifications

Product Name Alternative

Elastase-specific inhibitor ; ESIPeptidase inhibitor 3 ; PI-3; Protease inhibitor WAP3Skin-derived antileukoproteinase ; SKALPWAP four-disulfide core domain protein 14

Abbreviation

Recombinant Human PI3 protein

Gene Name

PI3

UniProt

P19957

Expression Region

61-117aa

Organism

Homo sapiens (Human)

Target Sequence

AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.

Molecular Weight

22 kDa

References & Citations

Primary structure of the human elafin precursor preproelafin deduced from the nucleotide sequence of its gene and the presence of unique repetitive sequences in the prosegment.Saheki T., Ito F., Hagiwara H., Saito Y., Kuroki J., Tachibana S., Hirose S.Biochem. Biophys. Res. Commun. 185:240-245 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MI-538
BA4689-5.1 1 mL (10 mM in DMSO)

MI-538

Sign In for Pricing
View Details
Thyroid Stimulating Hormone, intact (TSHintact)
MBS623948-01 0.1 mg

Thyroid Stimulating Hormone, intact (TSHintact)

Sign In for Pricing
View Details
Thyroid Stimulating Hormone, intact (TSHintact)
MBS623948-02 1 mg

Thyroid Stimulating Hormone, intact (TSHintact)

Sign In for Pricing
View Details
Thyroid Stimulating Hormone, intact (TSHintact)
MBS623948-03 5x 1 mg

Thyroid Stimulating Hormone, intact (TSHintact)

Sign In for Pricing
View Details
Copine-6 Rabbit Polyclonal Antibody (Cy3)
orb987299 100 µL

Copine-6 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
4-1BB Ligand (4-1BBL) (Carboxyfluorescein) discontinued
0004-01F 100 Tests

4-1BB Ligand (4-1BBL) (Carboxyfluorescein) discontinued

Sign In for Pricing
View Details