Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prohibitin (PHB)

Product Specifications

Product Name Alternative

Epididymis luminal protein 215; Epididymis secretory sperm binding protein Li 54e; HEL 215; HEL S 54e; PHB; PHB_HUMAN; PHB1; Prohibitin

Abbreviation

Recombinant Human PHB protein

Gene Name

PHB

UniProt

P35232

Expression Region

1-272aa

Organism

Homo sapiens (Human)

Target Sequence

MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transcription

Relevance

Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.

Molecular Weight

33.8 kDa

References & Citations

The human prohibitin gene located on chromosome 17q21 is mutated in sporadic breast cancer.Sato T., Saito H., Swensen J., Olifant A., Wood C., Danner D., Sakamoto T., Takita K., Kasumi F., Miki Y., Skolnick M., Nakamura Y.Cancer Res. 52:1643-1646 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TENT4B sgRNA gene knockout kit - Lentiviral human TENT4B sgRNA gene knockout kit (25)
GTR15360669 1 Vial

Lentiviral human TENT4B sgRNA gene knockout kit - Lentiviral human TENT4B sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Recombinant Mouse ST6GALNAC2/SIAT7-B Protein, N-His
orb3057368-01 50 µg

Recombinant Mouse ST6GALNAC2/SIAT7-B Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse ST6GALNAC2/SIAT7-B Protein, N-His
orb3057368-02 100 µg

Recombinant Mouse ST6GALNAC2/SIAT7-B Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse ST6GALNAC2/SIAT7-B Protein, N-His
orb3057368-03 1 mg

Recombinant Mouse ST6GALNAC2/SIAT7-B Protein, N-His

Sign In for Pricing
View Details
DDX11L6 Protein Vector (Human) (pPB-C-His)
PV072481 500 ng

DDX11L6 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
RBM5 Antibody
orb1279940 100 µL

RBM5 Antibody

Sign In for Pricing
View Details