Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nephrin (NPHS1), partial

Product Specifications

Product Name Alternative

Renal glomerulus-specific cell adhesion receptor

Abbreviation

Recombinant Human NPHS1 protein, partial

Gene Name

NPHS1

UniProt

O60500

Expression Region

23-257aa

Organism

Homo sapiens (Human)

Target Sequence

QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Adhesion

Relevance

Ses to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Seems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion (By similarity) .

Molecular Weight

29.1 kDa

References & Citations

A spectrum of novel NPHS1 and NPHS2 gene mutations in pediatric nephrotic syndrome patients from Pakistan.Abid A., Khaliq S., Shahid S., Lanewala A., Mubarak M., Hashmi S., Kazi J., Masood T., Hafeez F., Naqvi S.A., Rizvi S.A., Mehdi S.Q.Gene 502:133-137 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shank2 siRNA Oligos set (Mouse)
43691174 3x 5 nmol

Shank2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Sdr42e1 shRNA (UAS) - Lentiviral mouse Sdr42e1 shRNA (UAS, RFP) (100)
GTR15273036 1 Vial

Lentiviral mouse Sdr42e1 shRNA (UAS) - Lentiviral mouse Sdr42e1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
TTC12 Rabbit Polyclonal Antibody
JOT-AP13243-01 20 µL

TTC12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTC12 Rabbit Polyclonal Antibody
JOT-AP13243-02 50 μL

TTC12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTC12 Rabbit Polyclonal Antibody
JOT-AP13243-03 100 µL

TTC12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Ethyl-2- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) aniline
OR1085745 250 mg

4-Ethyl-2- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) aniline

Sign In for Pricing
View Details