Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nephrocystin-1 (NPHP1), partial

Product Specifications

Product Name Alternative

Juvenile nephronophthisis 1 protein

Abbreviation

Recombinant Human NPHP1 protein, partial

Gene Name

NPHP1

UniProt

O15259

Expression Region

1-109aa

Organism

Homo sapiens (Human)

Target Sequence

MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRENIT

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Together with BCAR1 it may play a role in the control of epithelial cell polarity. Involved in the organization of apical junctions in kidney cells together with NPHP4 and RPGRIP1L/NPHP8 . Does not se to be strictly required for ciliogenesis . Ses to help to recruit PTK2B/PYK2 to cell matrix adhesions, thereby initiating phosphorylation of PTK2B/PYK2 and PTK2B/PYK2-dependent signaling. May play a role in the regulation of intraflagellar transport (IFT) during cilia assbly. Required for normal retina development. In connecting photoreceptor cilia influences the movent of some IFT proteins such as IFT88 and WDR19. Involved in spermatogenesis .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Together with BCAR1 it may play a role in the control of epithelial cell polarity. Involved in the organization of apical junctions in kidney cells together with NPHP4 and RPGRIP1L/NPHP8 (By similarity) . Does not seem to be strictly required for ciliogenesis (By similarity) . Seems to help to recruit PTK2B/PYK2 to cell matrix adhesions, thereby initiating phosphorylation of PTK2B/PYK2 and PTK2B/PYK2-dependent signaling. May play a role in the regulation of intraflagellar transport (IFT) during cilia assembly. Required for normal retina development. In connecting photoreceptor cilia influences the movement of some IFT proteins such as IFT88 and WDR19. Involved in spermatogenesis (By similarity) .

Molecular Weight

39.7 kDa

References & Citations

Mutations in KIF7 link Joubert syndrome with Sonic Hedgehog signaling and microtubule dynamics.Dafinger C., Liebau M.C., Elsayed S.M., Hellenbroich Y., Boltshauser E., Korenke G.C., Fabretti F., Janecke A.R., Ebermann I., Nurnberg G., Nurnberg P., Zentgraf H., Koerber F., Addicks K., Elsobky E., Benzing T., Schermer B., Bolz H.J.J. Clin. Invest. 121:2662-2667 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ATP6V0A4 Protein Vector (Human) (pPM-C-HA)
12770021 500 ng

ATP6V0A4 Protein Vector (Human) (pPM-C-HA)

Ask
View Details
HRP-Linked Polyclonal Antibody to Heat Shock 10kDa Protein 1 (HSP10)
MBS2055977-01 0.1 mL

HRP-Linked Polyclonal Antibody to Heat Shock 10kDa Protein 1 (HSP10)

Ask
View Details
HRP-Linked Polyclonal Antibody to Heat Shock 10kDa Protein 1 (HSP10)
MBS2055977-02 0.2 mL

HRP-Linked Polyclonal Antibody to Heat Shock 10kDa Protein 1 (HSP10)

Ask
View Details
HRP-Linked Polyclonal Antibody to Heat Shock 10kDa Protein 1 (HSP10)
MBS2055977-03 0.5 mL

HRP-Linked Polyclonal Antibody to Heat Shock 10kDa Protein 1 (HSP10)

Ask
View Details
HRP-Linked Polyclonal Antibody to Heat Shock 10kDa Protein 1 (HSP10)
MBS2055977-04 1 mL

HRP-Linked Polyclonal Antibody to Heat Shock 10kDa Protein 1 (HSP10)

Ask
View Details
HRP-Linked Polyclonal Antibody to Heat Shock 10kDa Protein 1 (HSP10)
MBS2055977-05 5 mL

HRP-Linked Polyclonal Antibody to Heat Shock 10kDa Protein 1 (HSP10)

Ask
View Details