Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nucleolar protein 3 (NOL3)

Product Specifications

Product Name Alternative

Apoptosis repressor with CARD1

Abbreviation

Recombinant Human NOL3 protein

Gene Name

NOL3

UniProt

O60936

Expression Region

1-208aa

Organism

Homo sapiens (Human)

Target Sequence

MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Apoptosis

Relevance

Isoform 1: May be involved in RNA splicing.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Isoform 1

Molecular Weight

38.6 kDa

References & Citations

Screening of mutations in NOL3 in a myoclonic syndromes series.Macerollo A., Mencacci N.E., Erro R., Cordivari C., Edwards M.J., Wood N.W., Bhatia K.P.J. Neurol. 261:1830-1831 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF405S conjugate, 0.1mg/mL
BNC041865-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human FGF21 (Fibroblast Growth Factor 21) CLIA Kit
E-CL-H0074-01 24 Tests

Human FGF21 (Fibroblast Growth Factor 21) CLIA Kit

Sign In for Pricing
View Details
Human FGF21 (Fibroblast Growth Factor 21) CLIA Kit
E-CL-H0074-02 48 Tests

Human FGF21 (Fibroblast Growth Factor 21) CLIA Kit

Sign In for Pricing
View Details
Human FGF21 (Fibroblast Growth Factor 21) CLIA Kit
E-CL-H0074-03 96 Tests

Human FGF21 (Fibroblast Growth Factor 21) CLIA Kit

Sign In for Pricing
View Details
NOB1 (NM_014062) Human Recombinant Protein
TP309537M 100 µg

NOB1 (NM_014062) Human Recombinant Protein

Sign In for Pricing
View Details
ICAM1 Mouse Monoclonal Antibody [Clone ID: 1H4]
AM03205AF-N 100 µg

ICAM1 Mouse Monoclonal Antibody [Clone ID: 1H4]

Sign In for Pricing
View Details