Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein BEX3 (NGFRAP1)

Product Specifications

Product Name Alternative

Brain-expressed X-linked protein 3Nerve growth factor receptor-associated protein 1Ovarian granulosa cell 13.0KDA protein HGR74p75NTR-associated cell death executor

Abbreviation

Recombinant Human NGFRAP1 protein

Gene Name

NGFRAP1

UniProt

Q00994

Expression Region

1-111aa

Organism

Homo sapiens (Human)

Target Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Apoptosis

Relevance

May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death . May play an important role in the pathogenesis of neurogenetic diseases.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity) . May play an important role in the pathogenesis of neurogenetic diseases.

Molecular Weight

40 kDa

References & Citations

A comparative gene expression profile of the whole eye from human, mouse, and guinea pig.Zhou X., Wang W., Lu F., Hu S., Jiang L., Yan D., Zhang X., Yu X., Yu J., Qu J.Mol. Vis. 13:2214-2221 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), Biotin conjugate, 0.1mg/mL
BNCB0160-100 1x 100 µL

CD20 (B9E9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW08F-PAG/W 10x 96 Well Plates

Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details
Recombinant Human DOPA Decarboxylase/DDC Protein (His Tag)
PKSH030408 50 µg

Recombinant Human DOPA Decarboxylase/DDC Protein (His Tag)

Sign In for Pricing
View Details
PRKAR2B (regulatory subunit) Recombinant Rabbit Monoclonal Antibody [JA11-69]
ET1704-15 100 µL

PRKAR2B (regulatory subunit) Recombinant Rabbit Monoclonal Antibody [JA11-69]

Sign In for Pricing
View Details
Human PDI (PDIA2) activation kit by CRISPRa
GA112110 1 Kit

Human PDI (PDIA2) activation kit by CRISPRa

Sign In for Pricing
View Details
MARK3 (NM_002376) Human Recombinant Protein
TP305758 20 µg

MARK3 (NM_002376) Human Recombinant Protein

Sign In for Pricing
View Details