Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Mpv17 (MPV17)

Product Specifications

Product Name Alternative

Glomerulosclerosis; Mpv17; Mpv17 human homolog of glomerulosclerosis and nephrotic syndrome; MpV17 mitochondrial inner membrane protein; MPV17_HUMAN; MTDPS6; Protein Mpv17; SYM1

Abbreviation

Recombinant Human MPV17 protein

Gene Name

MPV17

UniProt

P39210

Expression Region

1-176aa

Organism

Homo sapiens (Human)

Target Sequence

MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.

Molecular Weight

35.7 kDa

References & Citations

Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.Wang W., Shen P., Thiyagarajan S., Lin S., Palm C., Horvath R., Klopstock T., Cutler D., Pique L., Schrijver I., Davis R.W., Mindrinos M., Speed T.P., Scharfe C.Nucleic Acids Res. 39:44-58 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLFML1 Peptide - N-terminal region
MBS3237393-01 0.1 mg

OLFML1 Peptide - N-terminal region

Sign In for Pricing
View Details
OLFML1 Peptide - N-terminal region
MBS3237393-02 5x 0.1 mg

OLFML1 Peptide - N-terminal region

Sign In for Pricing
View Details
E2F1 Antibody
orb678005 100 µL

E2F1 Antibody

Sign In for Pricing
View Details
Recombinant USUV NS2a Protein (aa 1146–1372) [His]
VAng-Wyb3693-100g 100 µg

Recombinant USUV NS2a Protein (aa 1146–1372) [His]

Sign In for Pricing
View Details
IQCG Polyclonal Antibody, FITC Conjugated
bs-9022R-FITC 100 µL

IQCG Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Alpha smooth muscle Actin Rabbit Polyclonal Antibody (AP)
orb927323 100 µL

Alpha smooth muscle Actin Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details