Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lactadherin (MFGE8)

Product Specifications

Product Name Alternative

Breast epithelial antigen BA46HMFGMFGMMilk fat globule-EGF factor 8 ; MFG-E8SED1

Abbreviation

Recombinant Human MFGE8 protein

Gene Name

MFGE8

UniProt

Q08431

Expression Region

24-387aa

Organism

Homo sapiens (Human)

Target Sequence

LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization . Contributes to phagocytic roval of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction. Binds specifically to rotavirus and inhibits its replication.1 Publication

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization (By similarity) . Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction. Binds specifically to rotavirus and inhibits its replication.

Molecular Weight

56.8 kDa

References & Citations

Cloning and sequence analysis of human breast epithelial antigen BA46 reveals an RGD cell adhesion sequence presented on an epidermal growth factor-like domain.Couto J.R., Taylor M.R., Godwin S.G., Ceriani R.L., Peterson J.A.DNA Cell Biol. 15:281-286 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osteoprotegerin (TNFRSF11B) Mouse Monoclonal Antibody [Clone ID: 5A11]
AM06550SU-N 100 µL

Osteoprotegerin (TNFRSF11B) Mouse Monoclonal Antibody [Clone ID: 5A11]

Sign In for Pricing
View Details
SMAD6 Mouse Monoclonal Antibody [Clone ID: 5H3]
AM06507SU-N 100 µL

SMAD6 Mouse Monoclonal Antibody [Clone ID: 5H3]

Sign In for Pricing
View Details
Recombinant EpCAM Monoclonal Antibody
AN300999L-01 50 µL

Recombinant EpCAM Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant EpCAM Monoclonal Antibody
AN300999L-02 100 µL

Recombinant EpCAM Monoclonal Antibody

Sign In for Pricing
View Details
Desacetyllanatoside C
TRC-D288320-5MG 5 mg

Desacetyllanatoside C

Sign In for Pricing
View Details
Peroxiredoxin 4 (PRDX4) (NM_006406) Human Recombinant Protein
TP720568 10 µg

Peroxiredoxin 4 (PRDX4) (NM_006406) Human Recombinant Protein

Sign In for Pricing
View Details