Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Acyl-protein thioesterase 1 (Lypla1)

Product Specifications

Product Name Alternative

Lysophospholipase 1Lysophospholipase I ; LPL-I ; LysoPLA I

Abbreviation

Recombinant Mouse Lypla1 protein

Gene Name

Lypla1

UniProt

P97823

Expression Region

1-230aa

Organism

Mus musculus (Mouse)

Target Sequence

MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity (By similarity) .

Molecular Weight

51.7 kDa

References & Citations

Label-free quantitative proteomics of the lysine acetylome in mitochondria identifies substrates of SIRT3 in metabolic pathways.Rardin M.J., Newman J.C., Held J.M., Cusack M.P., Sorensen D.J., Li B., Schilling B., Mooney S.D., Kahn C.R., Verdin E., Gibson B.W.Proc. Natl. Acad. Sci. U.S.A. 110:6601-6606 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL1RAP Protein, N-His
AP97928 50 µg

Recombinant Mouse IL1RAP Protein, N-His

Sign In for Pricing
View Details
3- (Ethynyl) -2,2,5,5-tetramethyl-1-pyrrolidinyloxy
423223-01 5 mg

3- (Ethynyl) -2,2,5,5-tetramethyl-1-pyrrolidinyloxy

Sign In for Pricing
View Details
3- (Ethynyl) -2,2,5,5-tetramethyl-1-pyrrolidinyloxy
423223-02 10 mg

3- (Ethynyl) -2,2,5,5-tetramethyl-1-pyrrolidinyloxy

Sign In for Pricing
View Details
(±) 5 (6) -EET Ethanolamide
T211695-01 10 mg

(±) 5 (6) -EET Ethanolamide

Sign In for Pricing
View Details
(±) 5 (6) -EET Ethanolamide
T211695-02 50 mg

(±) 5 (6) -EET Ethanolamide

Sign In for Pricing
View Details
Raf-1 Polyclonal Antibody
ABP52313-01 30 µL

Raf-1 Polyclonal Antibody

Sign In for Pricing
View Details