Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-9 (LGALS9)

Product Specifications

Product Name Alternative

Ecalectin; Tumor antigen HOM-HD-21

Abbreviation

Recombinant Human LGALS9 protein

Gene Name

LGALS9

UniProt

O00182

Expression Region

1-323aa

Organism

Homo sapiens (Human)

Target Sequence

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Tag

N-terminal 6xHis-GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Binds galactosides. Has high affinity for the Forssman pentasaccharide. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Inhibits cell proliferation. It is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death. Isoform Short acts as an eosinophil choattractant.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds galactosides

Molecular Weight

65.9 kDa

References & Citations

Human galectin-9 isoform full-length cDNA from gastric adenocarcinoma.Kato S. Human ecalectin, a variant of human galectin-9, is a novel eosinophil chemoattractant produced by T lymphocytes.Matsumoto R., Matsumoto H., Seki M., Hata M., Asano Y., Kanegasaki S., Stevens R.L., Hirashima M.J. Biol. Chem. 273:16976-16984 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alarelin Acetate
A3151-500 500 mg

Alarelin Acetate

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni CJE0420 Protein (aa 27-201) (strain RM1221)
VAng-Ly2568-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Jejuni CJE0420 Protein (aa 27-201) (strain RM1221)

Sign In for Pricing
View Details
2- (((6- (Difluoromethoxy) -1H-benzo[d]imidazol-2-yl) sulfonyl) methyl) -3,4-dimethoxypyridine 1-oxide
PC1003443-01 100 mg

2- (((6- (Difluoromethoxy) -1H-benzo[d]imidazol-2-yl) sulfonyl) methyl) -3,4-dimethoxypyridine 1-oxide

Sign In for Pricing
View Details
2- (((6- (Difluoromethoxy) -1H-benzo[d]imidazol-2-yl) sulfonyl) methyl) -3,4-dimethoxypyridine 1-oxide
PC1003443-02 250 mg

2- (((6- (Difluoromethoxy) -1H-benzo[d]imidazol-2-yl) sulfonyl) methyl) -3,4-dimethoxypyridine 1-oxide

Sign In for Pricing
View Details
D-Luciferin Potassium Salt
TBS0008-1g 1 g

D-Luciferin Potassium Salt

Sign In for Pricing
View Details
CHEK1, Phosphorylated (S280) (Cell Cycle Checkpoint Kinase, CHK1) (APC)
MBS6411493-01 0.1 mL

CHEK1, Phosphorylated (S280) (Cell Cycle Checkpoint Kinase, CHK1) (APC)

Sign In for Pricing
View Details