Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NKG2-C type II integral membrane protein (KLRC2), partial

Product Specifications

Product Name Alternative

CD159 antigen-like family member CNK cell receptor CNKG2-C-activating NK receptor; CD159c

Abbreviation

Recombinant Human KLRC2 protein, partial

Gene Name

KLRC2

UniProt

P26717

Expression Region

94-231aa

Organism

Homo sapiens (Human)

Target Sequence

IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

Molecular Weight

31.8 kDa

References & Citations

The structural basis for intramembrane assembly of an activating immunoreceptor complex.Call M.E., Wucherpfennig K.W., Chou J.J.Nat. Immunol. 11:1023-1029 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKB1 Rabbit Polyclonal Antibody
orb2955391-01 50 µg

NFKB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NFKB1 Rabbit Polyclonal Antibody
orb2955391-02 100 µg

NFKB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPAG5 Rabbit pAb
E45R26543N-50 50 µL

SPAG5 Rabbit pAb

Sign In for Pricing
View Details
STX1A Antibody
A73200-50UL 50 μL

STX1A Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Integrin beta 1D Antibody (1G2) [DyLight 350]
NBP1-97733UV 0.1 mL

Mouse Monoclonal Integrin beta 1D Antibody (1G2) [DyLight 350]

Sign In for Pricing
View Details
Pigeon Carboxypeptidase A3, Mast Cell ELISA Kit
MBS083307 Inquire

Pigeon Carboxypeptidase A3, Mast Cell ELISA Kit

Sign In for Pricing
View Details