Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein-7 (KLK7), partial

Product Specifications

Product Name Alternative

Serine protease 6Stratum corneum chymotryptic enzyme ; hSCCE

Abbreviation

Recombinant Human KLK7 protein, partial

Gene Name

KLK7

UniProt

P49862

Expression Region

28-253aa

Organism

Homo sapiens (Human)

Target Sequence

DKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-|-Gln-15' and insulin B chain at '6-Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-|-Gln-15' and insulin B chain at '6-Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.

Molecular Weight

51.7 kDa

References & Citations

Vaspin inhibits kallikrein 7 by serpin mechanism.Heiker J.T., Kloting N., Kovacs P., Kuettner E.B., Strater N., Schultz S., Kern M., Stumvoll M., Bluher M., Beck-Sickinger A.G.Cell. Mol. Life Sci. 70:2569-2583 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal DLG1 Antibody (S06-6C8)
NBP3-20002-100ul 100 µL

Rabbit Monoclonal DLG1 Antibody (S06-6C8)

Ask
View Details
Arsg (NM_028710) Mouse Tagged ORF Clone Lentiviral Particle
MR208429L4V 200 µL

Arsg (NM_028710) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
CLIA Kit for Stromal Cell Derived Factor 2 Like Protein 1 (SDF2L1)
MBS2000548-01 24 Strip Well

CLIA Kit for Stromal Cell Derived Factor 2 Like Protein 1 (SDF2L1)

Ask
View Details
CLIA Kit for Stromal Cell Derived Factor 2 Like Protein 1 (SDF2L1)
MBS2000548-02 48 Well

CLIA Kit for Stromal Cell Derived Factor 2 Like Protein 1 (SDF2L1)

Ask
View Details
CLIA Kit for Stromal Cell Derived Factor 2 Like Protein 1 (SDF2L1)
MBS2000548-03 96 Well

CLIA Kit for Stromal Cell Derived Factor 2 Like Protein 1 (SDF2L1)

Ask
View Details
CLIA Kit for Stromal Cell Derived Factor 2 Like Protein 1 (SDF2L1)
MBS2000548-04 5x 96 Well

CLIA Kit for Stromal Cell Derived Factor 2 Like Protein 1 (SDF2L1)

Ask
View Details