Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PCNA-associated factor (PCLAF)

Product Specifications

Product Name Alternative

Hepatitis C virus NS5A-transactivated protein 9 ; HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1 ; OEATC-1; PCNA-associated factor of 15KDA ; PAF15 ; p15PAF

Abbreviation

Recombinant Human PCLAF protein

Gene Name

PCLAF

UniProt

Q15004

Expression Region

1-111aa

Organism

Homo sapiens (Human)

Target Sequence

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.

Molecular Weight

39 kDa

References & Citations

KIAA0101 is overexpressed, and promotes growth and invasion in adrenal cancer.Jain M., Zhang L., Patterson E.E., Kebebew E.PLoS ONE 6:E26866-E26866 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Forkhead Box Protein O3, Recombinant, Human, aa372-673, His-SUMO-Tag
584570-01 20 µg

Forkhead Box Protein O3, Recombinant, Human, aa372-673, His-SUMO-Tag

Sign In for Pricing
View Details
Forkhead Box Protein O3, Recombinant, Human, aa372-673, His-SUMO-Tag
584570-02 100 µg

Forkhead Box Protein O3, Recombinant, Human, aa372-673, His-SUMO-Tag

Sign In for Pricing
View Details
ANKRD9 Protein Vector (Human) (pPB-C-His)
PV062481 500 ng

ANKRD9 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral human ZBTB34 shRNA (UAS) - Lentiviral human ZBTB34 shRNA (UAS) (100)
GTR15161262 1 Vial

Lentiviral human ZBTB34 shRNA (UAS) - Lentiviral human ZBTB34 shRNA (UAS) (100)

Sign In for Pricing
View Details
Msrb3 Mouse Pre-designed siRNA Set A
HY-RS19718 1 Set

Msrb3 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Canine Thrombopoietin (THPO), N-His-TRxA
AP1C45-01 1 mg

Recombinant Canine Thrombopoietin (THPO), N-His-TRxA

Sign In for Pricing
View Details