Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Potassium voltage-gated channel subfamily E member 2 (Kcne2)

Product Specifications

Product Name Alternative

MinK-related peptide 1Minimum potassium ion channel-related peptide 1; Potassium channel subunit beta MiRP1

Abbreviation

Recombinant Rat Kcne2 protein

Gene Name

Kcne2

UniProt

P63161

Expression Region

1-123aa

Organism

Rattus norvegicus (Rat)

Target Sequence

MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Ancillary protein that assbles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr) . May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with KCNQ1/KCLQT1 and elicit a voltage-independent current .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1

Molecular Weight

18.4 kDa

References & Citations

MinK-related peptide 1 a beta subunit for the HCN ion channel subunit family enhances expression and speeds activation.Yu H., Wu J., Potapova I., Wymore R.T., Holmes B., Zuckerman J., Pan Z., Wang H., Shi W., Robinson R.B., El-Maghrabi M.R., Benjamin W., Dixon J.E., McKinnon D., Cohen I.S., Wymore R.Circ. Res. 88:E84-E87 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat RL13 ELISA Kit
E105279 1 Each

Rat RL13 ELISA Kit

Ask
View Details
Goat Anti-Rabbit IgG-HRP
LF-SA8002 0.5 ml

Goat Anti-Rabbit IgG-HRP

Ask
View Details
Mouse Ints10 (NM_027590) AAV Particle
MR210189A1V 250 µL

Mouse Ints10 (NM_027590) AAV Particle

Ask
View Details
LGALS12 (NM_001142537) Human Tagged ORF Clone
RC226979 10 µg

LGALS12 (NM_001142537) Human Tagged ORF Clone

Ask
View Details