Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inositol-trisphosphate 3-kinase B (ITPKB), partial

Product Specifications

Product Name Alternative

Inositol 1,4,5-trisphosphate 3-kinase B ; IP3 3-kinase B ; IP3K B ; InsP 3-kinase B

Abbreviation

Recombinant Human ITPKB protein, partial

Gene Name

ITPKB

UniProt

P27987

Expression Region

442-946aa

Organism

Homo sapiens (Human)

Target Sequence

RVEGGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQRQDSDALPSPELLPQDPDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQVTEAFREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQDAPLA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

72.5 kDa

References & Citations

An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD209 Nanobody (SAA1327)
RHJ61601 100 μg

Anti-Human CD209 Nanobody (SAA1327)

Sign In for Pricing
View Details
KIF2C Antibody (N-term) Blocking peptide
MBS9220407-01 0.5 mg

KIF2C Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
KIF2C Antibody (N-term) Blocking peptide
MBS9220407-02 5x 0.5 mg

KIF2C Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
Anti-human TACSTD2/TROP-2 Monoclonal
Y090045 100 µg

Anti-human TACSTD2/TROP-2 Monoclonal

Sign In for Pricing
View Details
Mouse Monoclonal CEACAM5/CD66e Antibody (SPM330) [Alexa Fluor 647]
NBP2-47974AF647 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (SPM330) [Alexa Fluor 647]

Sign In for Pricing
View Details
DLAT Rabbit Monoclonal Antibody
AMRe84191-01 1 Each

DLAT Rabbit Monoclonal Antibody

Sign In for Pricing
View Details