Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Interleukin-8 (IL8)

Product Specifications

Product Name Alternative

C-X-C motif chemokine hemokine (C-X-C motif) ligand 8

Abbreviation

Recombinant Sheep IL8 protein

Gene Name

IL8

UniProt

P36925

Expression Region

23-101aa

Organism

Ovis aries (Sheep)

Target Sequence

AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.

Molecular Weight

13.1 kDa

References & Citations

Sequencing of the ovine interleukin-8-encoding cDNA using the polymerase chain reaction.Legastelois I., Greenland T., Arnaud P., Mornex J.F., Cordier G.Gene 150:367-369 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PGM2 Antibody [HRP]
NBP2-99596H 0.1 mL

Rabbit Polyclonal PGM2 Antibody [HRP]

Sign In for Pricing
View Details
Recombinant Vaccinia virus Ribonucleoside-diphosphate reductase small chain (F14)
MBS1139283-01 0.02 mg (E-Coli)

Recombinant Vaccinia virus Ribonucleoside-diphosphate reductase small chain (F14)

Sign In for Pricing
View Details
Recombinant Vaccinia virus Ribonucleoside-diphosphate reductase small chain (F14)
MBS1139283-02 0.02 mg (Yeast)

Recombinant Vaccinia virus Ribonucleoside-diphosphate reductase small chain (F14)

Sign In for Pricing
View Details
Recombinant Vaccinia virus Ribonucleoside-diphosphate reductase small chain (F14)
MBS1139283-03 0.1 mg (E-Coli)

Recombinant Vaccinia virus Ribonucleoside-diphosphate reductase small chain (F14)

Sign In for Pricing
View Details
Recombinant Vaccinia virus Ribonucleoside-diphosphate reductase small chain (F14)
MBS1139283-04 0.1 mg (Yeast)

Recombinant Vaccinia virus Ribonucleoside-diphosphate reductase small chain (F14)

Sign In for Pricing
View Details
Recombinant Vaccinia virus Ribonucleoside-diphosphate reductase small chain (F14)
MBS1139283-05 0.02 mg (Baculovirus)

Recombinant Vaccinia virus Ribonucleoside-diphosphate reductase small chain (F14)

Sign In for Pricing
View Details