Recombinant Dog Interleukin-8 (CXCL8)
Product Specifications
Product Name Alternative
C-X-C motif chemokine hemokine (C-X-C motif) ligand 8
Abbreviation
Recombinant Dog IL8 protein
Gene Name
IL8
UniProt
P41324
Expression Region
23-101aa
Organism
Canis lupus familiaris (Dog) (Canis familiaris)
Target Sequence
AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Tag
N-terminal GST-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Others
Relevance
IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Molecular Weight
36.1 kDa
References & Citations
Borrelia burgdorferi migrates into joint capsules and causes an up-regulation of interleukin-8 in synovial membranes of dogs experimentally infected with ticks.Straubinger R.K., Straubinger A.F., Harter L., Jacobson R.H., Chang Y.-F., Summers B.A., Erb H.N., Appel M.J.Infect. Immun. 65:1273-1285 (1997)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-M542512-10MG 10 mg
Mono(2-ethyl-5-hydroxyhexyl) Phthalate-d4 (Mixture of Diastereomers)
Sign In for Pricing
View Details 
BNC742783-100 1x 100 µL
C1QA / Complement C1q A-Chain (C1QA/2783), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
#31066-T 1 Kit
AccuGreenTM High Sensitivity dsDNA Quantitation Kit (100 assays)
Sign In for Pricing
View Details 
BNC400100-100 1x 100 µL
CMV-p65 (CMV100), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details