Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Interleukin-4 (IL4)

Product Specifications

Product Name Alternative

B-cell stimulatory factor 1 ; BSF-1Lymphocyte stimulatory factor 1

Abbreviation

Recombinant Dog IIL4 protein

Gene Name

IL4

UniProt

O77762

Expression Region

25-132aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.

Molecular Weight

16.8 kDa

References & Citations

Molecular cloning, expression and characterization of the Canis familiaris interleukin-4.Wondimu A., Veit M., Kohn B., Kaul S., Hoffmann A., Brunnberg L., Schmidt M.F.Cytokine 16:88-92 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BPIL1, NT (RYSR, Long Palate, Lung And Nasal Epithelium Carcinoma-associated Protein 2, Bactericidal/Permeability-increasing Protein-like 1, C20orf184, LPLUNC2, UNQ2489/PRO5776) (Biotin) discontinued
B0003-41-Biotin 200 µL

BPIL1, NT (RYSR, Long Palate, Lung And Nasal Epithelium Carcinoma-associated Protein 2, Bactericidal/Permeability-increasing Protein-like 1, C20orf184, LPLUNC2, UNQ2489/PRO5776) (Biotin) discontinued

Sign In for Pricing
View Details
GANAB Rabbit Polyclonal Antibody
E10G05731 100 µL

GANAB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH
H-5734.0005 5.0mg

(D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH

Sign In for Pricing
View Details
Il2rb Antibody (APC)
orb1251609 0.1 mg

Il2rb Antibody (APC)

Sign In for Pricing
View Details
ACTR-IC Antibody
C11368-01 50 μL

ACTR-IC Antibody

Sign In for Pricing
View Details
ACTR-IC Antibody
C11368-02 100 µL

ACTR-IC Antibody

Sign In for Pricing
View Details