Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Interleukin-1 beta (IL1B)

Product Specifications

Product Name Alternative

IL1BInterleukin-1 beta; IL-1 beta

Abbreviation

Recombinant Sheep IL1B protein

Gene Name

IL1B

UniProt

P21621

Expression Region

114-266aa

Organism

Ovis aries (Sheep)

Target Sequence

AAVQSVKCKLQDREQKSLVLDSPCVLKALHLPSQEMSREVVFCMSFVQGEERDNKIPVALGIRDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEEKPVFLGRFRGGQDITDFRMETLSP

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.

Molecular Weight

21.7 kDa

References & Citations

Molecular cloning and characterization of ovine IL-1 alpha and IL-1 beta.Andrews A.E., Barcham G.J., Brandon M.R., Nash A.D.Immunology 74:453-460 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFNB, Recombinant, E.coli (Oxygen-insensitive NAD (P) H Nitroreductase, Dihydropteridine Reductase, FMN-dependent Nitroreductase, nfnB, dprA, nfsB, nfsI, ntr, b0578, JW0567)
N2350-60-01 100 µg

NFNB, Recombinant, E.coli (Oxygen-insensitive NAD (P) H Nitroreductase, Dihydropteridine Reductase, FMN-dependent Nitroreductase, nfnB, dprA, nfsB, nfsI, ntr, b0578, JW0567)

Sign In for Pricing
View Details
NFNB, Recombinant, E.coli (Oxygen-insensitive NAD (P) H Nitroreductase, Dihydropteridine Reductase, FMN-dependent Nitroreductase, nfnB, dprA, nfsB, nfsI, ntr, b0578, JW0567)
N2350-60-02 500 µg

NFNB, Recombinant, E.coli (Oxygen-insensitive NAD (P) H Nitroreductase, Dihydropteridine Reductase, FMN-dependent Nitroreductase, nfnB, dprA, nfsB, nfsI, ntr, b0578, JW0567)

Sign In for Pricing
View Details
Goat Anti-Mouse IgG Fc-HRP
1033-05 1.0 mL

Goat Anti-Mouse IgG Fc-HRP

Sign In for Pricing
View Details
HIF-1 Alpha Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-62518R-BF680-01 20 µL

HIF-1 Alpha Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
HIF-1 Alpha Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-62518R-BF680-02 100 µL

HIF-1 Alpha Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
DDX55 Peptide
MBS3228126-01 0.1 mg

DDX55 Peptide

Sign In for Pricing
View Details