Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Interleukin 17A (IL17A), partial

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Rabbit IL17A protein, partial

Gene Name

IL17A

UniProt

G1SLF2

Expression Region

21-153aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.3 kDa

References & Citations

"A high-resolution map of human evolutionary constraint using 29 mammals."Lindblad-Toh K., Garber M., Zuk O., Lin M.F., Parker B.J., Washietl S., Kheradpour P., Ernst J., Jordan G., Mauceli E., Ward L.D., Lowe C.B., Holloway A.K., Clamp M., Gnerre S., Alfoldi J., Beal K., Chang J. Kellis M.Nature 478:476-482 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HLA-A*0201 NY-ESO-1 complex Protein (C-10His)
PHH2307-01 10 µg

Recombinant Human HLA-A*0201 NY-ESO-1 complex Protein (C-10His)

Sign In for Pricing
View Details
Recombinant Human HLA-A*0201 NY-ESO-1 complex Protein (C-10His)
PHH2307-02 50 µg

Recombinant Human HLA-A*0201 NY-ESO-1 complex Protein (C-10His)

Sign In for Pricing
View Details
Recombinant Human HLA-A*0201 NY-ESO-1 complex Protein (C-10His)
PHH2307-03 500 µg

Recombinant Human HLA-A*0201 NY-ESO-1 complex Protein (C-10His)

Sign In for Pricing
View Details
PTF1A Antibody (Biotin)
orb52950-01 50 µg

PTF1A Antibody (Biotin)

Sign In for Pricing
View Details
PTF1A Antibody (Biotin)
orb52950-02 100 µg

PTF1A Antibody (Biotin)

Sign In for Pricing
View Details
NDUFA6 Recombinant Protein (Rat)
RP213512 100 µg

NDUFA6 Recombinant Protein (Rat)

Sign In for Pricing
View Details