Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Interleukin 17A (IL17A), partial

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Rabbit IL17A protein, partial

Gene Name

IL17A

UniProt

G1SLF2

Expression Region

21-153aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.3 kDa

References & Citations

"A high-resolution map of human evolutionary constraint using 29 mammals."Lindblad-Toh K., Garber M., Zuk O., Lin M.F., Parker B.J., Washietl S., Kheradpour P., Ernst J., Jordan G., Mauceli E., Ward L.D., Lowe C.B., Holloway A.K., Clamp M., Gnerre S., Alfoldi J., Beal K., Chang J. Kellis M.Nature 478:476-482 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD90/THY1 Monoclonal Antibody
orb3152766-01 50 µg

Human CD90/THY1 Monoclonal Antibody

Sign In for Pricing
View Details
Human CD90/THY1 Monoclonal Antibody
orb3152766-02 100 µg

Human CD90/THY1 Monoclonal Antibody

Sign In for Pricing
View Details
CLN-2 (Ceroid Lipofuscinosis Neuronal-2, TPP1, Tripeptidyl-peptidase 1)
216360 50 µg

CLN-2 (Ceroid Lipofuscinosis Neuronal-2, TPP1, Tripeptidyl-peptidase 1)

Sign In for Pricing
View Details
Catenin gamma recombinant monoclonal antibody
A5390 100ul X 3

Catenin gamma recombinant monoclonal antibody

Sign In for Pricing
View Details
RNMT siRNA (Rat)
CRR4161-01 15 nmol

RNMT siRNA (Rat)

Sign In for Pricing
View Details
RNMT siRNA (Rat)
CRR4161-02 30 nmol

RNMT siRNA (Rat)

Sign In for Pricing
View Details