Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-L-iduronidase (IDUA)

Product Specifications

Product Name Alternative

IDUA; Alpha-L-iduronidase; EC 3.2.1.76

Abbreviation

Recombinant Human IDUA protein

Gene Name

IDUA

UniProt

P35475

Expression Region

28-653aa

Organism

Homo sapiens (Human)

Target Sequence

APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

73.9 kDa

References & Citations

Human alpha-L-iduronidase uses its own N-glycan as a substrate-binding and catalytic module.Maita N., Tsukimura T., Taniguchi T., Saito S., Ohno K., Taniguchi H., Sakuraba H.Proc. Natl. Acad. Sci. U.S.A. 110:14628-14633 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cxcl9 shRNA (UAS) - Lentiviral mouse Cxcl9 shRNA (UAS, iRFP) (100)
GTR15234339 1 Vial

Lentiviral mouse Cxcl9 shRNA (UAS) - Lentiviral mouse Cxcl9 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Gja8 Mouse Gene Knockout Kit (CRISPR)
KN506483 1 Kit

Gja8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NDUFB7 Rabbit pAb
orb2712948-01 50 µL

NDUFB7 Rabbit pAb

Sign In for Pricing
View Details
NDUFB7 Rabbit pAb
orb2712948-02 100 µL

NDUFB7 Rabbit pAb

Sign In for Pricing
View Details
SV5-Pk (V5) Epitope Tag Recombinant Antibody AE00342
AE00342 0.2mg

SV5-Pk (V5) Epitope Tag Recombinant Antibody AE00342

Sign In for Pricing
View Details
TRIM65, ID (TRIM65, Tripartite motif-containing protein 65) (MaxLight 490)
MBS6358556-01 0.1 mL

TRIM65, ID (TRIM65, Tripartite motif-containing protein 65) (MaxLight 490)

Sign In for Pricing
View Details