Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DNA-binding protein inhibitor ID-1 (ID1)

Product Specifications

Product Name Alternative

Class B basic helix-loop-helix protein 24 ; bHLHb24Inhibitor of DNA binding 1Inhibitor of differentiation 1

Abbreviation

Recombinant Human ID1 protein

Gene Name

ID1

UniProt

P41134

Expression Region

1-155aa

Organism

Homo sapiens (Human)

Target Sequence

MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer (By similarity) .

Molecular Weight

32.1 kDa

References & Citations

Nucleotide sequence of the cDNA encoding human helix-loop-helix Id-1 protein identification of functionally conserved residues common to Id proteins.Deed R.W., Jasiok M., Norton J.D.Biochim. Biophys. Acta 1219:160-162 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Colony Stimulating Factor 2, Granulocyte Macrophage (GMCSF) ELISA Kit
RD-GMCSF-Mu-01 96 Tests

Mouse Colony Stimulating Factor 2, Granulocyte Macrophage (GMCSF) ELISA Kit

Sign In for Pricing
View Details
Mouse Colony Stimulating Factor 2, Granulocyte Macrophage (GMCSF) ELISA Kit
RD-GMCSF-Mu-02 48 Tests

Mouse Colony Stimulating Factor 2, Granulocyte Macrophage (GMCSF) ELISA Kit

Sign In for Pricing
View Details
VMAT2 (SLC18A2) Human Gene Knockout Kit (CRISPR)
KN421342 1 Kit

VMAT2 (SLC18A2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Endothall monohydrate
TRC-E555433-10MG 10 mg

Endothall monohydrate

Sign In for Pricing
View Details
MSI1 Human Gene Knockout Kit (CRISPR)
KN415992 1 Kit

MSI1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Chloro-4'-isopropyl-butyrophenone
TRC-C385918-500MG 500 mg

4-Chloro-4'-isopropyl-butyrophenone

Sign In for Pricing
View Details