Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Hemopexin (Hpx)

Product Specifications

Product Name Alternative

Hpx; Hemopexin

Abbreviation

Recombinant Rat Hpx protein

Gene Name

Hpx

UniProt

P20059

Expression Region

24-460aa

Organism

Rattus norvegicus (Rat)

Target Sequence

NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Binds he and transports it to the liver for breakdown and iron recovery, after which the free hopexin returns to the circulation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation.

Molecular Weight

52.9 kDa

References & Citations

Rat hemopexin. Molecular cloning, primary structural characterization, and analysis of gene expression.Nikkilae H., Gitlin J.D., Mueller-Eberhard U.Biochemistry 30:823-829 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau (S214) Antibody
KC-44298-01 50 μL

Tau (S214) Antibody

Sign In for Pricing
View Details
Tau (S214) Antibody
KC-44298-02 100 µL

Tau (S214) Antibody

Sign In for Pricing
View Details
Tau (S214) Antibody
KC-44298-03 1 mL

Tau (S214) Antibody

Sign In for Pricing
View Details
IF 2(Mt) (MTIF2) Rabbit Polyclonal Antibody
TA378751 100 µL

IF 2(Mt) (MTIF2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COL1A1 Recombinant Rabbit Monoclonal Antibody [ST58-04]
ET1609-68 100 µL

COL1A1 Recombinant Rabbit Monoclonal Antibody [ST58-04]

Sign In for Pricing
View Details
GAD65 Recombinant Chimeric Antibody Antibody
HA601455 100 µL

GAD65 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details