Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human General transcription factor IIH subunit 5 (GTF2H5)

Product Specifications

Product Name Alternative

General transcription factor IIH polypeptide 5TFB5 orthologTFIIH basal transcription factor complex TTD-A subunit

Abbreviation

Recombinant Human GTF2H5 protein

Gene Name

GTF2H5

UniProt

Q6ZYL4

Expression Region

1-71aa

Organism

Homo sapiens (Human)

Target Sequence

MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Component of the TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. Necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.

Molecular Weight

35.1 kDa

References & Citations

ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.Science 316:1160-1166 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DMEM (HG) With high-glucose and sodium pyruvate. W/O L-glutamine.
DML19-1000ML 1000 mL

DMEM (HG) With high-glucose and sodium pyruvate. W/O L-glutamine.

Ask
View Details
Human ZA20D3 (ZFAND6) (NM_019006) AAV Particle
RC202725A1V 250 µL

Human ZA20D3 (ZFAND6) (NM_019006) AAV Particle

Ask
View Details
Rabbit Polyclonal Atherin Antibody [Janelia Fluor 549]
NBP2-04030JF549 0.1 mL

Rabbit Polyclonal Atherin Antibody [Janelia Fluor 549]

Ask
View Details
Kansuinine E
380620 5 mg

Kansuinine E

Ask
View Details
Monkey Nuclear factor 1 C-type (NFIC) ELISA Kit
MBS7229682-01 48 Well

Monkey Nuclear factor 1 C-type (NFIC) ELISA Kit

Ask
View Details
Monkey Nuclear factor 1 C-type (NFIC) ELISA Kit
MBS7229682-02 96 Well

Monkey Nuclear factor 1 C-type (NFIC) ELISA Kit

Ask
View Details