Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Cynomolgus (HEK293, His)

The EDA2R/XEDAR proteins lack conserved residues critical for feature annotation propagation and exhibit unique characteristics that raise questions about their structural and functional aspects. This uniqueness suggests potential changes in molecular interactions and signaling pathways. EDA2R/XEDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-cynomolgus-hek293-his.html

Purity

98.00

Smiles

MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQEQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQE

Molecular Formula

102116506 (Gene_ID) XP_005593864.1 (M1-E136) (Accession)

Molecular Weight

Approximately 25-29 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Ovine Leptin  tA Protein, Untagged, E.coli-10ug
QP10757-10ug 10ug

Recombinant Ovine Leptin tA Protein, Untagged, E.coli-10ug

Sign In for Pricing
View Details
N-Acetyl-α-D-glucosamine 1-phosphate (disodium) (Standard)
HY-147063R 1 Each

N-Acetyl-α-D-glucosamine 1-phosphate (disodium) (Standard)

Sign In for Pricing
View Details
Mouse mmu-miR-7233-3p miRNA Agomir
abx884308-01 5 nmol

Mouse mmu-miR-7233-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-7233-3p miRNA Agomir
abx884308-02 10 nmol

Mouse mmu-miR-7233-3p miRNA Agomir

Sign In for Pricing
View Details
Recombinant Mouse Gstp1 Protein
ARP2356-01 10 µg

Recombinant Mouse Gstp1 Protein

Sign In for Pricing
View Details
Recombinant Mouse Gstp1 Protein
ARP2356-02 50 µg

Recombinant Mouse Gstp1 Protein

Sign In for Pricing
View Details