Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutaredoxin-1 (GLRX)

Product Specifications

Product Name Alternative

Thioltransferase-1 ; TTase-1

Abbreviation

Recombinant Human GLRX protein

Gene Name

GLRX

UniProt

P35754

Expression Region

1-106aa

Organism

Homo sapiens (Human)

Target Sequence

MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transport

Relevance

Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.

Molecular Weight

38.8 kDa

References & Citations

Cloning and sequencing of the cDNA encoding human glutaredoxin.Fernando M.R., Sumimoto H., Nanri H., Kawabata S., Iwanaga S., Minakami S., Fukumaki Y., Takeshige K.Biochim. Biophys. Acta 1218:229-231 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Receptor Subfamily 3, Group C, Member 1 (Glucocorticoid Receptor) (NR3C1) Antibody
abx037382-01 100 µg

Nuclear Receptor Subfamily 3, Group C, Member 1 (Glucocorticoid Receptor) (NR3C1) Antibody

Sign In for Pricing
View Details
Nuclear Receptor Subfamily 3, Group C, Member 1 (Glucocorticoid Receptor) (NR3C1) Antibody
abx037382-02 1 mg

Nuclear Receptor Subfamily 3, Group C, Member 1 (Glucocorticoid Receptor) (NR3C1) Antibody

Sign In for Pricing
View Details
ARHGAP33 Protein Vector (Mouse) (pPM-C-His)
PV155809 500 ng

ARHGAP33 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Human Forkhead Box Protein C1 ELISA kit
GTR10408750 96 Well

Human Forkhead Box Protein C1 ELISA kit

Sign In for Pricing
View Details
C6 Antibody
OACA10279-100UG 100 µg

C6 Antibody

Sign In for Pricing
View Details
Cadherin 10 (CDH10) Antibody
abx325131-01 50 µg

Cadherin 10 (CDH10) Antibody

Sign In for Pricing
View Details