Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glial cell line-derived neurotrophic factor (GDNF)

Product Specifications

Product Name Alternative

Astrocyte-derived trophic factor ; ATF

Abbreviation

Recombinant Human GDNF protein

Gene Name

GDNF

UniProt

P39905

Expression Region

78-211aa

Organism

Homo sapiens (Human)

Target Sequence

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.

Molecular Weight

31.1 kDa

References & Citations

GDNF a glial cell line-derived neurotrophic factor for midbrain dopaminergic neurons.Lin L.-F.H., Doherty D.H., Lile J.D., Bektesh S., Collins F.Science 260:1130-1132 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGP9.5 Antibody
E38PA9818 100 µL

PGP9.5 Antibody

Sign In for Pricing
View Details
TMEM229A shRNA (m) Lentiviral Particles
sc-140451-V 200 µL

TMEM229A shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Rat Hepatocyte Nuclear Factor 1 Alpha CLIA Kit
MBS8426772-01 1 Kit

Rat Hepatocyte Nuclear Factor 1 Alpha CLIA Kit

Sign In for Pricing
View Details
Rat Hepatocyte Nuclear Factor 1 Alpha CLIA Kit
MBS8426772-02 5x 1 Kit

Rat Hepatocyte Nuclear Factor 1 Alpha CLIA Kit

Sign In for Pricing
View Details
Human LRG1 Protein, Fc Tag
E40KMPH4298 20 µg

Human LRG1 Protein, Fc Tag

Sign In for Pricing
View Details
TAF11 (NM_005643) Human 3' UTR Clone
SC210727 10 µg

TAF11 (NM_005643) Human 3' UTR Clone

Sign In for Pricing
View Details