Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Rab GDP dissociation inhibitor beta (GDI2)

Product Specifications

Product Name Alternative

Guanosine diphosphate dissociation inhibitor 2 ; GDI-2

Abbreviation

Recombinant Human GDI2 protein

Gene Name

GDI2

UniProt

P50395

Expression Region

1-445aa

Organism

Homo sapiens (Human)

Target Sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from th, and the subsequent binding of GTP to th.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.

Molecular Weight

66.7 kDa

References & Citations

Asada M., Kaibuchi K., Takai Y. The human rab GDI beta gene with long retroposon-rich introns maps to 10p15 and its pseudogene to 7p11-p13.Sedlacek Z., Munstermann E., Mincheva A., Lichter P., Poutska A.Mamm. Genome 9:78-80 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Small nuclear ribonucleoprotein Sm D2, Snrpd2 ELISA KIT
ELI-19978m 96 Tests

Mouse Small nuclear ribonucleoprotein Sm D2, Snrpd2 ELISA KIT

Sign In for Pricing
View Details
c-Myb (MYB) (557-569) Goat Polyclonal Antibody
AP20174PU-N 100 µg

c-Myb (MYB) (557-569) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Olfr1351 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4204905 3x 1.0 µg

Olfr1351 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human PYHIN1 (NM_198930) AAV Particle
RC212276A1V 250 µL

Human PYHIN1 (NM_198930) AAV Particle

Sign In for Pricing
View Details
Blood DNA Isolation Midi Kit
51400 20 Preparations

Blood DNA Isolation Midi Kit

Sign In for Pricing
View Details
Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody [Clone ID: OTI5C9]
CF500584 100 µg

Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody [Clone ID: OTI5C9]

Sign In for Pricing
View Details