Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 5 (Gdf5)

Product Specifications

Product Name Alternative

Bone morphogenetic protein 14 ; BMP-14

Abbreviation

Recombinant Mouse Gdf5 protein

Gene Name

Gdf5

UniProt

P43027

Expression Region

376-495aa

Organism

Mus musculus (Mouse)

Target Sequence

APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with BMPR1A, leading to induction of SMAD1-SMAD5-SMAD8 complex phosphorylation and then SMAD protein signaling transduction . Secondly, negatively regulates chondrogenic differentiation through its interaction with NOG . Required to prevent excessive muscle loss upon denervation. This function requires SMAD4 and is mediated by phosphorylated SMAD1/5/8 . Binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory response, including TNF secretion by monocytes .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with BMPR1A, leading to induction of SMAD1-SMAD5-SMAD8 complex phosphorylation and then SMAD protein signaling transduction (By similarity) . Secondly, negatively regulates chondrogenic differentiation through its interaction with NOG (By similarity) . Required to prevent excessive muscle loss upon denervation. This function requires SMAD4 and is mediated by phosphorylated SMAD1/5/8

Molecular Weight

17.6 kDa

References & Citations

BMP signaling controls muscle mass.Sartori R., Schirwis E., Blaauw B., Bortolanza S., Zhao J., Enzo E., Stantzou A., Mouisel E., Toniolo L., Ferry A., Stricker S., Goldberg A.L., Dupont S., Piccolo S., Amthor H., Sandri M.Nat. Genet. 45:1309-1318 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)
MBS1098024-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)

Ask
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)
MBS1098024-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)

Ask
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)
MBS1098024-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)

Ask
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)
MBS1098024-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)

Ask
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)
MBS1098024-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)

Ask
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)
MBS1098024-06 1 mg (E-Coli)

Recombinant Arabidopsis thaliana Defensin-like protein 247 (SCRL6)

Ask
View Details