Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 5 (GAGE5)

Product Specifications

Product Name Alternative

Cancer/testis antigen 4.5 ; CT4.5

Abbreviation

Recombinant Human GAGE5 protein

Gene Name

GAGE5

UniProt

Q13069

Expression Region

1-117aa

Organism

Homo sapiens (Human)

Target Sequence

MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.9 kDa

References & Citations

A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.van den Eynde B., Peeters O., de Backer O., Gaugler B., Lucas S., Boon T.J. Exp. Med. 182:689-698 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zswim1 Mouse Gene Knockout Kit (CRISPR)
KN520162 1 Kit

Zswim1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Vti1a activation kit by CRISPRa
GA205586 1 Kit

Mouse Vti1a activation kit by CRISPRa

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (CDH16/1071), 0.2mg/mL
BNUB1071-500 1x 500 µL

Ksp-Cadherin / CDH16 (CDH16/1071), 0.2mg/mL

Sign In for Pricing
View Details
CD200R1L (NM_001008784) Human Over-expression Lysate
LY423379 100 µg

CD200R1L (NM_001008784) Human Over-expression Lysate

Sign In for Pricing
View Details
Thy1 Rat Monoclonal Antibody [Clone ID: 30-H12]
AM08055FC-S 100 µg

Thy1 Rat Monoclonal Antibody [Clone ID: 30-H12]

Sign In for Pricing
View Details
BROX (NM_144695) Human Recombinant Protein
TP321654M 100 µg

BROX (NM_144695) Human Recombinant Protein

Sign In for Pricing
View Details