Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 5 (GAGE5)

Product Specifications

Product Name Alternative

Cancer/testis antigen 4.5 ; CT4.5

Abbreviation

Recombinant Human GAGE5 protein

Gene Name

GAGE5

UniProt

Q13069

Expression Region

1-117aa

Organism

Homo sapiens (Human)

Target Sequence

MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.9 kDa

References & Citations

A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.van den Eynde B., Peeters O., de Backer O., Gaugler B., Lucas S., Boon T.J. Exp. Med. 182:689-698 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD49d Antibody[HP1/2]
E-AB-F1359D-01 20 Tests

PE Anti-Human CD49d Antibody[HP1/2]

Sign In for Pricing
View Details
PE Anti-Human CD49d Antibody[HP1/2]
E-AB-F1359D-02 100 Tests

PE Anti-Human CD49d Antibody[HP1/2]

Sign In for Pricing
View Details
PE Anti-Human CD49d Antibody[HP1/2]
E-AB-F1359D-03 2x 100 Tests

PE Anti-Human CD49d Antibody[HP1/2]

Sign In for Pricing
View Details
TSG101 (201-281) Mouse Monoclonal Antibody [Clone ID: 5B7]
AM31014PU-N 50 µg

TSG101 (201-281) Mouse Monoclonal Antibody [Clone ID: 5B7]

Sign In for Pricing
View Details
TPH2 Recombinant Chimeric Antibody Antibody
HA601493 100 µL

TPH2 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Chlorhexidine Digluconate Impurity N Hydrochloride
TRC-C377843-10MG 10 mg

Chlorhexidine Digluconate Impurity N Hydrochloride

Sign In for Pricing
View Details