Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 5 (GAGE5)

Product Specifications

Product Name Alternative

Cancer/testis antigen 4.5 ; CT4.5

Abbreviation

Recombinant Human GAGE5 protein

Gene Name

GAGE5

UniProt

Q13069

Expression Region

1-117aa

Organism

Homo sapiens (Human)

Target Sequence

MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.9 kDa

References & Citations

A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.van den Eynde B., Peeters O., de Backer O., Gaugler B., Lucas S., Boon T.J. Exp. Med. 182:689-698 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R9B Antibody (Biotin)
KB-3654-01 50 μL

PPP1R9B Antibody (Biotin)

Sign In for Pricing
View Details
PPP1R9B Antibody (Biotin)
KB-3654-02 100 µL

PPP1R9B Antibody (Biotin)

Sign In for Pricing
View Details
PPP1R9B Antibody (Biotin)
KB-3654-03 1 mL

PPP1R9B Antibody (Biotin)

Sign In for Pricing
View Details
CCDC37 (CFAP100) Human Gene Knockout Kit (CRISPR)
KN415041 1 Kit

CCDC37 (CFAP100) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/3298), CF488A conjugate, 0.1mg/mL
BNC883298-500 1x 500 µL

TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/3298), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (HH1/957), CF568 conjugate, 0.1mg/mL
BNC680957-500 1x 500 µL

Histone H1 (HH1/957), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details