Recombinant Human Forkhead box protein P1 (FOXP1), partial
Product Specifications
Product Name Alternative
Mac-1-regulated forkhead1
Abbreviation
Recombinant Human FOXP1 protein, partial
Gene Name
FOXP1
UniProt
Q9H334
Expression Region
1-114aa
Organism
Homo sapiens (Human)
Target Sequence
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQ
Tag
N-terminal GST-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Transcription
Relevance
Transcriptional repressor . Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential . Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal chord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in bryonic st cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T (FH) s. Involved in maintainance of hair follicle st cell quiescence; the function probably involves regulation of FGF18 . Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis . Binds to CSF1R promoter elents and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes ses to involve NCOR2 as corepressor . Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization ses to implicate suppression of SA5B . Can negatively regulate androgen receptor signaling .
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Transcriptional repressor
Molecular Weight
39.2 kDa
References & Citations
The FOXP1 winged helix transcription factor is a novel candidate tumor suppressor gene on chromosome 3p.Banham A.H., Beasley N., Campo E., Fernandez P.L., Fidler C., Gatter K., Jones M., Mason D.Y., Prime J.E., Trougouboff P., Wood K., Cordell J.L.Cancer Res. 61:8820-8829 (2001)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items