Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP3 (FKBP3)

Product Specifications

Product Name Alternative

25KDA FK506-binding protein ;25KDA FKBP ; FKBP-25FK506-binding protein 3 ; FKBP-3Immunophilin FKBP25Rapamycin-selective 25KDA immunophilinRotamase

Abbreviation

Recombinant Human FKBP3 protein

Gene Name

FKBP3

UniProt

Q00688

Expression Region

2-224aa

Organism

Homo sapiens (Human)

Target Sequence

AAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct Cytoplasmic domain signal transmission pathways. PPIases accelerate the folding of proteins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins.

Molecular Weight

41 kDa

References & Citations

Isolation of a human cDNA encoding a 25KDA FK-506 and rapamycin binding protein.Wiederrecht G., Martin M., Sigal N., Siekierka J.J.Biochem. Biophys. Res. Commun. 185:298-303 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP1 (Insulin-like Growth Factor-binding Protein 1, IBP-1, IGF-binding Protein 1, IGFBP-1, Placental Protein 12, PP12, IBP1) (APC)
143591-APC 100 µL

IGFBP1 (Insulin-like Growth Factor-binding Protein 1, IBP-1, IGF-binding Protein 1, IGFBP-1, Placental Protein 12, PP12, IBP1) (APC)

Sign In for Pricing
View Details
Mouse Nsmce1 ELISA KIT
ELI-22281m 96 Tests

Mouse Nsmce1 ELISA KIT

Sign In for Pricing
View Details
TMEM92 Protein Lysate (Human) with C-Ha Tag
47113031 100 µg

TMEM92 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
GPS2 Protein Vector (Rat) (pPB-N-His)
PV271347 500 ng

GPS2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
MED4 Antibody
MBS8518629-01 0.05 mg

MED4 Antibody

Sign In for Pricing
View Details
MED4 Antibody
MBS8518629-02 0.1 mg

MED4 Antibody

Sign In for Pricing
View Details