Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IgG receptor FcRn large subunit p51 (FCGRT), partial

Product Specifications

Product Name Alternative

IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor

Abbreviation

Recombinant Human FCGRT protein, partial

Gene Name

FCGRT

UniProt

P55899

Expression Region

24-297aa

Organism

Homo sapiens (Human)

Target Sequence

AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds to the Fc region of monomeric immunoglobulins gamma

Molecular Weight

57.4 kDa

References & Citations

The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ube2q2 activation kit by CRISPRa
GA212195 1 Kit

Mouse Ube2q2 activation kit by CRISPRa

Sign In for Pricing
View Details
BIN1 Mouse Monoclonal Antibody [Clone ID: 99F]
TA396773S 25 µL

BIN1 Mouse Monoclonal Antibody [Clone ID: 99F]

Sign In for Pricing
View Details
Anti-IL13RA1 Antibody, Rabbit Polyclonal
MBS8110956-01 0.1 mL

Anti-IL13RA1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-IL13RA1 Antibody, Rabbit Polyclonal
MBS8110956-02 5x 0.1 mL

Anti-IL13RA1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
C18orf19 3'UTR Luciferase Stable Cell Line
TU003112 1.0 mL

C18orf19 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human KLRC2 protein, N-His Tag
IMP-3821 10 µg

Recombinant Human KLRC2 protein, N-His Tag

Sign In for Pricing
View Details